Edit |   |
---|---|
Antigenic Specificity | Calretinin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Calretinin polyclonal antibody, unconjugated |
Immunogen | Calbindin 2 antibody was raised using the N terminal of CALB2 corresponding to a region with amino acids IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD |
Other Names | CAB29|CAL2|CR|29 kDa calbindin|calbindin 2|(29kD|calretinin)|calbindin D29K|calretinin|CALB2|29kDa|29kDa (calretinin)|wu:fq17g09|zgc:73099|(calretinin)|calbindin 2b|calb2b|calb2l|wu:fq18e08|zgc:73115|like|calbindin 2a|calb2a |
Gene, Accession # | Gene ID: 794, 12308, 117059 |
Catalog # | ABIN631478 |
Price | $1020 |
Order / More Info | Calretinin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |