Edit |   |
---|---|
Antigenic Specificity | FAM83E |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FAM83E polyclonal antibody, unconjugated |
Immunogen | FAM83 E antibody was raised using the middle region of FAM83 corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM |
Other Names | protein FAM83E|family with sequence similarity 83 member E|FAM83E|Family with Sequence Similarity 83, Member E|4930403C10Rik|RGD1309316 |
Gene, Accession # | Gene ID: 54854 |
Catalog # | ABIN632448 |
Price | $1020 |
Order / More Info | FAM83E Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |