Edit |   |
---|---|
Antigenic Specificity | PFKL |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PFKL polyclonal antibody, unconjugated |
Immunogen | PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA |
Other Names | PFK-B|6-phosphofructokinase|liver type|liver-type 1-phosphofructokinase|phosphofructo-1-kinase isozyme B|phosphofructokinase 1|phosphohexokinase|phosphofructokinase, liver type|PFKL|Phosphofructokinase, Liver|AA407869|phosphofructokinase, liver, B-type|phosphofructokinase|liver|B-type|ATP-dependent 6-phosphofructokinase|phosphofructokinase, liver a|pfkla |
Gene, Accession # | Gene ID: 5211, 18641, 25741, 487797 |
Catalog # | ABIN629821 |
Price | $902 |
Order / More Info | PFKL Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |