Edit |   |
---|---|
Antigenic Specificity | RBMS1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RBMS1 polyclonal antibody, unconjugated |
Immunogen | RBMS1 antibody was raised using the C terminal of RBMS1 corresponding to a region with amino acids TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ |
Other Names | C2orf12|HCC-4|MSSP|MSSP-1|MSSP-2|MSSP-3|SCR2|YC1|RNA-binding motif|single-stranded-interacting protein 1|c-myc gene single strand binding protein 2|cervical cancer oncogene 4|single-stranded DNA-binding protein MSSP-1|suppressor of CDC2 with RNA-binding motif 2|suppressor of cdc 2 (cdc13) with RNA binding motif 2|RNA binding motif single stranded interacting protein 1|RBMS1|RNA Binding Motif, Single Stranded Interacting Protein 1|2600014B10Rik|AI255215|RNA binding motif, single stranded interacting protein 1 S homeolog|rbms1.S|RNA binding motif|single stranded interacting protein 1|single-stranded-interacting protein 1-like|fe16a10|wu:fe16a10|RNA binding motif, single stranded interacting protein 1a|rbms1a |
Gene, Accession # | Gene ID: 5937, 56878, 478764 |
Catalog # | ABIN630197 |
Price | $902 |
Order / More Info | RBMS1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |