Edit |   |
---|---|
Antigenic Specificity | SLC13A3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC13A3 polyclonal antibody, unconjugated |
Immunogen | SLC13 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF |
Other Names | NADC3|SDCT2|Na(+)dicarboxylate cotransporter 3|hNaDC3|naDC-3|sodium-dependent high affinity dicarboxylate transporter 3|sodium-dependent high-affinity dicarboxylate transporter 2|solute carrier family 13 member 3|SLC13A3|mNaDC3|solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3|solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 L homeolog|slc13a3.L|MGC108337|solute carrier family 13 (sodium-dependent dicarboxylate transporter)|member 3|rNaDC3|sodium-dependent high-affinity dicarboxylate transporter 3|zgc:77173 |
Gene, Accession # | Gene ID: 64849 |
Catalog # | ABIN630395 |
Price | $902 |
Order / More Info | SLC13A3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |