Edit |   |
---|---|
Antigenic Specificity | GABRG2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GABRG2 polyclonal antibody, unconjugated |
Immunogen | GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR |
Other Names | GABAA-R|Gabrg-2|gamma2|gamma-aminobutyric acid receptor subunit gamma-2|gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2|Gabrg2|gamma-aminobutyric Acid (GABA) A Receptor, gamma 2|gamma-aminobutyric acid type A receptor gamma2 subunit|gamma-aminobutyric acid A receptor gamma 2|GABA(A) receptor subunit gamma-2|CAE2|ECA2|GEFSP3|GABA(A) receptor|gamma 2|GABA-A receptor gamma-2 subunit|gabrg1|gamma-aminobutyric acid A receptor|gamma 1|gamma-aminobutyric acid (GABA) A receptor|gamma-aminobutyric acid receptor subunit gamma-2-like|gamma-aminobutyric acid A receptor|gamma-aminobutyric acid (GABA-A) receptor|subunit gamma 2|gamma-aminobutyric acid type A receptor gamma 2 subunit|si:ch211-145n14.1 |
Gene, Accession # | Gene ID: 2566, 14406, 29709, 489141 |
Catalog # | ABIN630118 |
Price | $902 |
Order / More Info | GABRG2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |