Edit |   |
---|---|
Antigenic Specificity | AGBL5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-AGBL5 polyclonal antibody, unconjugated |
Immunogen | AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS |
Other Names | ATPGTP-binding protein-like 5|cytosolic carboxypeptidase-like protein 5|ATP/GTP binding protein like 5|AGBL5|ATP/GTP Binding Protein-Like 5|4930455N08|9430057O19Rik|CCP5|carboxypeptidase 5|cytosolic|zgc:91997|MGC83526|ATPGTP binding protein-like 5|ATP/GTP binding protein-like 5 L homeolog|agbl5.L|cytosolic carboxypeptidase-like protein 5-like|LOC100181588 |
Gene, Accession # | Gene ID: 60509 |
Catalog # | ABIN630529 |
Price | $1020 |
Order / More Info | AGBL5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |