Edit |   |
---|---|
Antigenic Specificity | RAN |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | C. elegans, dog, Drosophila melanogaster, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RAN polyclonal antibody, unconjugated |
Immunogen | Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA |
Other Names | ARA24|Gsp1|TC4|GTP-binding nuclear protein Ran|GTPase Ran|OKSW-cl.81|RanGTPase|androgen receptor-associated protein 24|guanosine triphosphatase Ran|member RAS oncogene family|ras-like protein TC4|ras-related nuclear protein|RAN, member RAS oncogene family|RAN|RAN, member RAS oncogene family S homeolog|ran.S|ran-1|RANP1|member RAS oncogene family pseudogene 1|AAF30287|CG1404|DmelCG1404|dran|l(1)G0075|ran10A|CG1404-PA|CG1404-PB|Ran GTPase|ran-PA|ran-PB|CG1404 gene product from transcript CG1404-RC|fc16b04|wu:fc16b04 |
Gene, Accession # | Gene ID: 5901, 19428, 44072, 84509, 442976 |
Catalog # | ABIN634102 |
Price | $1020 |
Order / More Info | RAN Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |