Edit |   |
---|---|
Antigenic Specificity | RDBP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RDBP polyclonal antibody, unconjugated |
Immunogen | RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS |
Other Names | D6S45|NELF-E|RD|RDBP|RDP|RD RNA binding protein|RD RNA-binding protein|RNA-binding protein RD|major histocompatibility complex gene RD|negative elongation factor E|negative elongation factor polypeptide E|nuclear protein|negative elongation factor complex member E|NELFE|D17H6S45|negative elongation factor complex member E, Rdbp|CG5994|DmelCG5994|NELF|anon-66Da|dNelf-E|CG5994-PA|Nelf-E-PA|anonymous-66Da|negative elongation factor|negative elongation factor complex member E L homeolog|nelfe.L|zgc:92496 |
Gene, Accession # | Gene ID: 7936, 27632, 294258 |
Catalog # | ABIN633256 |
Price | $1020 |
Order / More Info | RDBP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |