Edit |   |
---|---|
Antigenic Specificity | Raly |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Raly polyclonal antibody, unconjugated |
Immunogen | RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ |
Other Names | HNRPCL2|P542|RNA binding protein|autoantigenic (hnRNP-associated with lethal yellow homolog)|RNA-binding protein (autoantigenic)|RNA-binding protein (autoantigenic|hnRNP-associated with lethal yellow)|RNA-binding protein Raly|autoantigen p542|heterogeneous nuclear ribonucleoprotein C-like 2|hnRNP associated with lethal yellow protein homolog|hnRNP core protein C-like 2|RALY heterogeneous nuclear ribonucleoprotein|RALY|AI663842|Merc|hnRNP associated with lethal yellow protein|maternally-expressed hnRNP C-related protein|hnRNP-associated with lethal yellow|zgc:103445|RNA binding protein (autoantigenic|hnRNP-associated with lethal yellow) short isoform|autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) |
Gene, Accession # | Gene ID: 22913 |
Catalog # | ABIN630644 |
Price | $1020 |
Order / More Info | Raly Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |