Edit |   |
---|---|
Antigenic Specificity | Fibrillarin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Fibrillarin polyclonal antibody, unconjugated |
Immunogen | Fibrillarin antibody was raised using the N terminal of FBL corresponding to a region with amino acids GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN |
Other Names | FIB|FLRN|RNU3IP1|34 kDa nucleolar scleroderma antigen|34-kD nucleolar scleroderma antigen|RNA|U3 small nucleolar interacting protein 1|rRNA 2'-O-methyltransferase fibrillarin|fibrillarin|FBL|wu:fb37g12|zgc:56145|zgc:77130|fb37g12|nucleolar protein 1|AL022665|CG9888|DmelCG9888|Fibri|GCR-6|GCR6|Pen59C5|CG9888-PA|Fib-PA|MGC76139|fib1|putative fibrillarin|LMJF_19_0100|histone-glutamine methyltransferase|fibrillarin S homeolog|fbl.S |
Gene, Accession # | Gene ID: 2091, 14113, 292747, 476460 |
Catalog # | ABIN629933 |
Price | $902 |
Order / More Info | Fibrillarin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |