Edit |   |
---|---|
Antigenic Specificity | GOLGA5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GOLGA5 polyclonal antibody, unconjugated |
Immunogen | GOLGA5 antibody was raised using the N terminal of GOLGA5 corresponding to a region with amino acids FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS |
Other Names | GOLIM5|RFG5|ret-II|Golgin subfamily A member 5|RET-fused gene 5 protein|cell proliferation-inducing gene 31 protein|golgi autoantigen|golgin subfamily a|5|golgi integral membrane protein 5|golgin-84|golgin A5|GOLGA5|golgin A5 L homeolog|golga5.L|golgin subfamily A member 5-like|protein Sumiko|golgi autoantigen, golgin subfamily a, 5|im:7153094|sb:cb898|wu:fd50h11|zgc:66400 |
Gene, Accession # | Gene ID: 995, 27277, 299258 |
Catalog # | ABIN635542 |
Price | $1020 |
Order / More Info | GOLGA5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |