Edit |   |
---|---|
Antigenic Specificity | BACE1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-BACE1 polyclonal antibody, unconjugated |
Immunogen | BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY |
Other Names | ASP2|BACE|HSPC104|APP beta-secretase|asp 2|aspartyl protease 2|beta-secretase 1|beta-secretase 1 precursor variant 1|beta-site APP cleaving enzyme 1|beta-site amyloid beta A4 precursor protein-cleaving enzyme|memapsin-2|membrane-associated aspartic protease 2|transmembrane aspartic proteinase Asp2|BACE1|C76936|beta-site amyloid precursor protein cleaving enzyme 1|beta-site APP cleaving enzyme|beta secretase 1|beta-secretase 1 isoform A preproprotein|beta-secretase 1 isoform B preproprotein|beta-secretase 1 isoform C preproprotein|MGC145931|beta-site APP-cleaving enzyme 1|beta-secretase 1-like|zgc:77409 |
Gene, Accession # | Gene ID: 23621, 23821, 29392 |
Catalog # | ABIN635849 |
Price | $1020 |
Order / More Info | BACE1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |