Edit |   |
---|---|
Antigenic Specificity | KIF13B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KIF13B polyclonal antibody, unconjugated |
Immunogen | KIF13 B antibody was raised using the N terminal of KIF13 corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE |
Other Names | kinesin family member 13B|KIF13B|kinesin family member 13Ba|kif13ba|5330429L19Rik|6030414C01|AI429803|C130021D12Rik|GAKIN|N-3 kinesin|kinesin 13B|kinesin-like protein KIF13B|xKIF13b|kinesin family member 13B L homeolog|kif13b.L|guanylate kinase associated kinesin|kinesin-like protein GAKIN |
Gene, Accession # | Gene ID: 16554, 23303, 305967 |
Catalog # | ABIN634243 |
Price | $1020 |
Order / More Info | KIF13B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |