Edit |   |
---|---|
Antigenic Specificity | ATP5B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ATP5B polyclonal antibody, unconjugated |
Immunogen | ATP5 B antibody was raised using the N terminal of ATP5 corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ |
Other Names | ATPMB|ATPSB|ATP synthase subunit beta|mitochondrial|mitochondrial ATP synthase beta subunit|mitochondrial ATP synthetase|beta subunit|ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide|ATP5B|ATP synthase|H+ transporting mitochondrial F1 complex|F1-ATPase beta-subunit|f1-ATPase beta|mitochondrial ATP synthase|H+ transporting F1 complex beta subunit|H+ transporting|mitochondrial F1 complex|beta polypeptide|hm:zehn0534|im:6793121|wu:fj38d01|zgc:111961|Atpsyn-beta|ATP synthase-beta|OXPHOS complex V beta chain|ATP synthase beta subunit|mitochondrial-like|ATP synthase subunit beta, mitochondrial|LOC100401662|LOC100635763|alpha subunit|ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit|ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide S homeolog|atp5b.S |
Gene, Accession # | Gene ID: 506, 11947, 171374 |
Catalog # | ABIN629672 |
Price | $902 |
Order / More Info | ATP5B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |