Edit |   |
---|---|
Antigenic Specificity | PEX3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PEX3 polyclonal antibody, unconjugated |
Immunogen | PEX3 antibody was raised using the N terminal of PEX3 corresponding to a region with amino acids KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL |
Other Names | PBD10A|TRG18|peroxin-3|peroxisomal assembly protein PEX3|transformation-related protein 18|peroxisomal biogenesis factor 3|PEX3|LOC692959|CpipJ_CPIJ013204|DDBDRAFT_0204086|DDBDRAFT_0238047|DDB_0204086|DDB_0238047|transmembrane protein|peroxin 3|1700014F15Rik|2810027F19Rik|2900010N04Rik|peroxisomal assembly protein 3|zgc:56313|peroxisomal biogenesis factor 3 L homeolog|pex3.L |
Gene, Accession # | Gene ID: 8504, 56535, 83519, 484015 |
Catalog # | ABIN629613 |
Price | $902 |
Order / More Info | PEX3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |