Edit |   |
---|---|
Antigenic Specificity | Annexin V |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | chemical |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Annexin V polyclonal antibody, unconjugated |
Immunogen | Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE |
Other Names | ANX5|ENX2|PP4|RPRGL3|CBP-I|PAP-I|VAC-alpha|anchorin CII|annexin V|annexin-5|calphobindin I|endonexin II|lipocortin V|placental anticoagulant protein 4|placental anticoagulant protein I|thromboplastin inhibitor|vascular anticoagulant-alpha|annexin A5|ANXA5|R74653|LC5|annexin 5|annexin V (endonexin II)|anx|ANX V|cb989|wu:fa98f06|wu:fj10f10|annexin A5b|anxa5b|annexin A5 L homeolog|anxa5.L|MGC89158|annexin A5-like |
Gene, Accession # | Gene ID: 308, 11747 |
Catalog # | ABIN630241 |
Price | $902 |
Order / More Info | Annexin V Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |