Edit |   |
---|---|
Antigenic Specificity | CAMKII gamma |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CAMKII gamma polyclonal antibody, unconjugated |
Immunogen | CAMKII antibody was raised using the N terminal of CAMKK2 corresponding to a region with amino acids GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM |
Other Names | CAMK|CAMK-II|CAMKG|caMK-II subunit gamma|calciumcalmodulin-dependent protein kinase (CaM kinase) II gamma|calciumcalmodulin-dependent protein kinase type II subunit gamma|calcium/calmodulin dependent protein kinase II gamma|CAMK2G|Calcium/calmodulin-Dependent Protein Kinase II gamma|CAMKII gamma|caM kinase II subunit gamma|caM-kinase II gamma chain|calciumcalmodulin-dependent protein kinase type II gamma chain|calciumcalmodulin-dependent protein kinase II gamma|5930429P18Rik|Ca2+calmodulin-dependent protein kinase II|CaMK II|CaM kinase II gamma B|CaM kinase II gamma C-1|CaM kinase II gamma C-2|CaM kinase II gamma G-1|CaM kinase II gamma G-2|CaM kinase II gamma J |
Gene, Accession # | Gene ID: 818 |
Catalog # | ABIN634349 |
Price | $1020 |
Order / More Info | CAMKII gamma Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |