Edit |   |
---|---|
Antigenic Specificity | ACTR2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ACTR2 polyclonal antibody, unconjugated |
Immunogen | ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE |
Other Names | ARP2|actin-like protein 2|actin-related protein 2|ARP2 actin related protein 2 homolog|ACTR2|4921510D23Rik|AA409782|D6Ertd746e|ARP2 actin-related protein 2 homolog|ARP2 actin-related protein 2|actin-like protein ACTL|hm:zeh1257|zgc:63719|actin-like protein 2-A|actin-related protein 2-A|ARP2 actin related protein 2a homolog|actr2a|ARP2 actin-related protein 2 homolog (yeast)|DKFZp459N093|actin-related protein 2-like|actin-related protein Arp2|ACTIN RELATED PROTEIN 2|ATARP2|WRM|WURM|actr2-A|arp2-A|ARP2 actin-related protein 2 homolog S homeolog|actr2.S|zgc:110550|actin-like protein 2-B|actin-related protein 2-B|ARP2 actin related protein 2b homolog|actr2b|ARP2/3 actin-organizing complex subunit Arp2 |
Gene, Accession # | Gene ID: 10097, 66713, 289820, 481396 |
Catalog # | ABIN629770 |
Price | $902 |
Order / More Info | ACTR2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |