Edit |   |
---|---|
Antigenic Specificity | SHB |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SHB polyclonal antibody, unconjugated |
Immunogen | SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY |
Other Names | RP11-3J10.8|bA3J10.2|SH2 domain-containing adapter protein B|SHB (Src homology 2 domain containing) adaptor protein B|SHB adaptor protein (a Src homology 2 protein)|SH2 domain containing adaptor protein B|SHB|Src Homology 2 Domain Containing Adaptor Protein B|SH2 domain-containing adapter protein B-like|BC028832|src homology 2 domain-containing transforming protein B|RGD1565350 |
Gene, Accession # | Gene ID: 6461, 230126 |
Catalog # | ABIN634335 |
Price | $1020 |
Order / More Info | SHB Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |