Edit |   |
---|---|
Antigenic Specificity | GIPC2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GIPC2 polyclonal antibody, unconjugated |
Immunogen | GIPC2 antibody was raised using the N terminal of GIPC2 corresponding to a region with amino acids MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH |
Other Names | SEMCAP-2|SEMCAP2|PDZ domain protein GIPC2|PDZ domain-containing protein GIPC2|semaF cytoplasmic domain associated protein 2|semaphorin cytoplasmic domain associated protein 2|GIPC PDZ domain containing family member 2|GIPC2|GIPC PDZ Domain Containing Family, Member 2|2200002N01Rik|AU021850|semaF cytoplasmic domain-associated protein 2|gipc1|rgs19ip1|zgc:56157|zgc:77689|GIPC PDZ domain containing family|member 1|regulator of G-protein signalling 19 interacting protein 1|MGC85196|gipc|GAIP-interacting protein|member 2|kermit 2|GIPC PDZ domain containing family member 2 S homeolog|gipc2.S |
Gene, Accession # | Gene ID: 54810 |
Catalog # | ABIN629789 |
Price | $902 |
Order / More Info | GIPC2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |