Edit |   |
---|---|
Antigenic Specificity | NOP56 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-NOP56 polyclonal antibody, unconjugated |
Immunogen | NOL5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK |
Other Names | NOL5A|SCA36|NOP56 ribonucleoprotein homolog|nucleolar protein 56|nucleolar protein 5A (56kDa with KKED repeat)|NOP56 ribonucleoprotein|NOP56|An16g03090|ANI_1_440144|AO090005001291|AOR_1_2236174|2310044F10Rik|56kDa with KKED repeat|nucleolar protein 5A|xnop56|XNop56 protein|NOP56 ribonucleoprotein L homeolog|nop56.L |
Gene, Accession # | Gene ID: 10528 |
Catalog # | ABIN633377 |
Price | $1020 |
Order / More Info | NOP56 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |