Edit |   |
---|---|
Antigenic Specificity | MICA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MICA polyclonal antibody, unconjugated |
Immunogen | MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ |
Other Names | MIC-A|PERB11.1|HLA class I antigen|MHC class I chain-related protein A|stress inducible class I homolog|MHC class I polypeptide-related sequence A|MICA|F10 alpha chain-like|class I histocompatibility antigen |
Gene, Accession # | Gene ID: 100507436 |
Catalog # | ABIN634664 |
Price | $1020 |
Order / More Info | MICA Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |