Edit |   |
---|---|
Antigenic Specificity | ROBO2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ROBO2 polyclonal antibody, unconjugated |
Immunogen | ROBO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK |
Other Names | SAX3|roundabout homolog 2|roundabout guidance receptor 2|ROBO2|Roundabout, Axon Guidance Receptor, Homolog 2|roundabout 2 precursor|Roundabout2 protein|roundabout|axon guidance receptor|homolog 2 (Drosophila)|homolog 2|roundabout homolog 2-like|CG14347|CG14348|CG5481|CG5574|CT17326|D-Robo2|DmelCG5481|Robo 2|Robo-2|anon-EST:Liang-1.75|clone 1.75|dRobo-2|fus4|CG5481-PA|CG5481-PB|Roundabout2|SGP cluster fusion defects 4|lea-PA|lea-PB|roundabout 2|unp1881|ast|astray|zmp:0000000549|roundabout, axon guidance receptor, homolog 2 (Drosophila)|2600013A04Rik|9430089E08Rik|BB097918|D230004I22Rik|mKIAA1568|roundabout-2|roundabout guidance receptor 2 S homeolog|robo2.S|LOW QUALITY PROTEIN: roundabout homolog 2 |
Gene, Accession # | Gene ID: 84409, 268902 |
Catalog # | ABIN635030 |
Price | $1020 |
Order / More Info | ROBO2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |