Edit |   |
---|---|
Antigenic Specificity | OPTN |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-OPTN polyclonal antibody, unconjugated |
Immunogen | Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII |
Other Names | ALS12|FIP2|GLC1E|HIP7|HYPL|NRP|TFIIIA-INTP|E3-14.7K-interacting protein|FIP-2|HIP-7|Huntingtin interacting protein L|huntingtin yeast partner L|huntingtin-interacting protein 7|huntingtin-interacting protein L|nemo-related protein|optic neuropathy-inducing protein|transcription factor IIIA-interacting protein|transcrption factor IIIA-interacting protein|tumor necrosis factor alpha-inducible cellular protein containing leucine zipper domains|optineurin|OPTN|4930441O07Rik|14.7K-interacting protein 2|FIP-2-like protein|fj52f04|si:ch211-240l19.3|wu:fj52f04|zgc:66386|zgc:77868|ag9-C5|optineurin L homeolog|optn.L|optineurin-like |
Gene, Accession # | Gene ID: 10133, 71648, 246294 |
Catalog # | ABIN631194 |
Price | $1020 |
Order / More Info | OPTN Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |