Edit |   |
---|---|
Antigenic Specificity | RAB40C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RAB40C polyclonal antibody, unconjugated |
Immunogen | RAB40 C antibody was raised using the N terminal of RAB40 corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS |
Other Names | RARL|RASL8C|RAR (RAS like GTPASE) like|RAR like|RAS-like GTPase|RAS-like|family 8|member C|SOCS box-containing protein RAR3|rar-like protein|ras-like protein family member 8C|ras-related protein Rab-40C|RAB40C, member RAS oncogene family|RAB40C|RAR3|SOCS box containing protein RAR3|member RAS oncogene family|cb453|wu:fk50d06|zgc:136966|Wfikkn1|WAP|FS|Ig|KU|and NTR-containing protein 1|Kazal|immunoglobulin|Kunitz and NTR domain-containing protein 1|follistatinkazal|kunitz and netrin domain containing 1|LOC100715088|rab40|Rab40 GTPase|uncharacterized protein LOC495014|RAB40C, member RAS oncogene family L homeolog|rab40c.L |
Gene, Accession # | Gene ID: 57799 |
Catalog # | ABIN632024 |
Price | $1020 |
Order / More Info | RAB40C Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |