Edit |   |
---|---|
Antigenic Specificity | Coilin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Coilin polyclonal antibody, unconjugated |
Immunogen | Coilin antibody was raised using the C terminal of COIL corresponding to a region with amino acids DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ |
Other Names | coilin|Coil|p80c|CLN80|wu:fb08h11|coilin p80|p80-coilin|p80|C79982|nuclear phosphoprotein of Cajal body|CG8710|DmelCG8710|CG8710-PC|CG8710-PD|coil-PC|coil-PD|dcoilin|sph1|sphere organelles protein SPH-1|sphere protein 1|coilin L homeolog|coil.L|LOC100218802|F3F19.5|F3F19_5|sphere organelles protein-like protein|AT1G13030 |
Gene, Accession # | Gene ID: 8161 |
Catalog # | ABIN631002 |
Price | $1020 |
Order / More Info | Coilin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |