Edit |   |
---|---|
Antigenic Specificity | IL6R |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | IL6R Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR). |
Other Names | Interleukin-6 receptor subunit alpha;IL-6 receptor subunit alpha;IL-6R subunit alpha;IL-6R-alpha;IL-6RA;IL-6R 1;Membrane glycoprotein 80;gp80;CD126;IL6R; |
Gene, Accession # | UniProt: P08887 |
Catalog # | orb402463 |
Price | $520 |
Order / More Info | IL6R Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558