Edit |   |
---|---|
Antigenic Specificity | SARS-CoV-2 (COVID-19) ORF8 protein |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | n/a |
Isotype | n/a |
Format | unconjugated |
Size | 0.1 mg |
Concentration | batch dependent |
Applications | ELISA |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | SARS-CoV-2 (COVID-19) ORF8 protein polyclonal antibody |
Immunogen | MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
Other Names | Non-structural protein 8,ns8,ORF8 protein |
Gene, Accession # | n/a |
Catalog # | orb1272800 |
Price | $855 |
Order / More Info | SARS-CoV-2 (COVID-19) ORF8 protein Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558