Edit |   |
---|---|
Antigenic Specificity | EGFR |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | EGFR Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human EGFR (25-57aa LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNN), different from the related mouse sequence by two amino acids. |
Other Names | Epidermal growth factor receptor;2.7.10.1;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1;EGFR;ERBB, ERBB1, HER1; |
Gene, Accession # | UniProt: P00533 |
Catalog # | orb402311 |
Price | $520 |
Order / More Info | EGFR Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558