Edit |   |
---|---|
Antigenic Specificity | Green Fluorescent Protein (GFP) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | n/a |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 500 ug |
Concentration | n/a |
Applications | n/a |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The product is affinity purified and specifically recognizes the Green Fluorescent Protein (GFP). The antibody can be used for variety of application. The antibody is rabbit polyclonal antibody raised against Green Fluorescent Protein (GFP). It has been selected for its ability to recognize GFP in immunohistochemical staining and western blotting.It is recommended that the end user optimizes the product for their particular application with appropriate controls. |
Immunogen | Recombinant GFP (KETWWETWWTEWSQPKKKRKGMet1~Lys238myc-FLAG tag) expressed in E.coli |
Other Names | n/a |
Gene, Accession # | n/a |
Catalog # | orb1678899 |
Price | $442 |
Order / More Info | Green Fluorescent Protein (GFP) Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558