Edit |   |
---|---|
Antigenic Specificity | TPP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | TPP1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human TPP1 (227-261aa CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids. |
Other Names | Tripeptidyl-peptidase 1;TPP-1;3.4.14.9;Cell growth-inhibiting gene 1 protein;Lysosomal pepstatin-insensitive protease;LPIC;Tripeptidyl aminopeptidase;Tripeptidyl-peptidase I;TPP-I;TPP1;CLN2;GIG1, UNQ267/PRO304; |
Gene, Accession # | UniProt: O14773 |
Catalog # | orb334632 |
Price | $520 |
Order / More Info | TPP1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558