Edit |   |
---|---|
Antigenic Specificity | SLC6A4 |
Clone | CBP10036 |
Host Species | Mouse |
Reactive Species | human; rat; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | ELISA; IP; S-ELISA; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-SLC6A4/5-HTTLPR/Serotonin transporter Antibody, Clone N16455P (CBP10036) |
Immunogen | SLC6A4 (NP_001036, 181 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS |
Other Names | HTT; 5HTT; OCD1; SERT; 5-HTT; SERT1; hSERT; 5-HTTLPR |
Gene, Accession # | UniProt: P31645 |
Catalog # | NRZP-0822-ZP2019 |
Price | please inquire |
Order / More Info | SLC6A4 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |