Edit |   |
---|---|
Antigenic Specificity | ADNP |
Clone | CBP10430 |
Host Species | Mouse |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; ELISA; ICC; IF; S-ELISA; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-ADNP Antibody, Clone N27656P (CBP10430) |
Immunogen | ADNP (NP_056154, 1018 a.a. ~ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA |
Other Names | ADNP1; HVDAS; MRD28 |
Gene, Accession # | UniProt: Q9H2P0 |
Catalog # | NRZP-0822-ZP2728 |
Price | please inquire |
Order / More Info | ADNP Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |