Edit |   |
---|---|
Antigenic Specificity | ABCC9 |
Clone | N319A/14 |
Host Species | n/a |
Reactive Species | rat; mouse; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC; ICC; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-SUR2A BBB Shuttle Antibody, Clone N319A/14 |
Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A, accession number P70170) Rat: 97% identity (41/42 amino acids identical) Human: 92% identity (39/42 amino acids identical) 100% identity with SUR2C <50% identity with SUR2B |
Other Names | ATP Binding Cassette Subfamily C Member 9; Sulfonylurea Receptor 2; ATP-Binding Cassette; Sub-Family C (CFTR/MRP); Member 9; SUR2; ATP-Binding Cassette Transporter Sub-Family C Member 9; ATP-Binding Cassette Sub-Family C Member 9; |
Gene, Accession # | UniProt: P70170 |
Catalog # | NRZP-0423-ZP401 |
Price | please inquire |
Order / More Info | ABCC9 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |