TMEM16A/ANO1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TMEM16A/ANO1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TMEM16A/ANO1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for TMEM16A detection. Tested with WB in Human; Mouse; Rat.Background: Anoctamin-1 (ANO1), also known as oral cancer overexpressed 2 (ORAOV2) or tumor-amplified and overexpressed sequence 2 (TMEM16A), is a protein that in humans is encoded by the ANO1 gene. This gene belongs to a family of membrane proteins containing 8 transmembrane segments, and it is mapped to 11q13.3. ANO1 is a candidate calcium-activated chloride channel that mediates receptor-activated chloride currents in diverse physiologic processes, and it is thought to be responsible for a voltage-sensitive calcium-activated chloride current. Its overexpression was reported in es |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human TMEM16A (QQIHKEK VLMVELFMREEQDKQQLLETWMEKERQKDE). |
| Other Names | [Anoctamin-1; Discovered on gastrointestinal stromal tumors protein 1; Oral cancer overexpressed protein 2; Transmembrane protein 16A; Tumor-amplified and overexpressed sequence 2; ANO1; DOG1; ORAOV2; TAOS2; TMEM16A; Anoctamin 1, calcium activated chloride channel] |
| Gene, Accession # | [TMEM16A], Gene ID: 55107, NCBI: NP_060513.5, UniProt: Q5XXA6 |
| Catalog # | MBS1751268 |
| Price | $315 |
| Order / More Info | TMEM16A/ANO1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Caputo A, Caci E, Ferrera L, Pedemonte N, Barsanti C, Sondo E, Pfeffer U, Ravazzolo R, Zegarra-Moran O, Galietta LJ (October 2008). TMEM16A, a membrane protein associated with calcium-dependent chloride channel activity. Science 322 (5901): 590-4.Hai, T., Liu, F., Coukos, W. J., Green, M. R.Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.Genes Dev. 3: 2083-2090, 1989. 2. Katoh M, Katoh M (June 2003). FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products. Int. J. Oncol. 22 (6): 1375-81. 3. Yang, Y. D., Cho, H., Koo, J. Y., Tak, M. H., Cho, Y., Shim, W.-S., Park, S. P., Lee, J., Lee, B., Kim, B.-M., Raouf, R., Shin, Y. K., Oh, U. TMEM16A confers receptor-activated calcium-dependent chloride conductance. Nature 455: 1210-1215, 2008. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies