IL6R/Il 6 R Alpha Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-IL6R/Il 6 R Alpha Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | IL6R/Il 6 R Alpha Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding d |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR). Subcellular Localization: Isoform 1: Basolateral cell membrane; Single-pass type I membrane protein. Tissue Specificity: Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum. |
| Other Names | [Interleukin-6 receptor subunit alpha; IL-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; IL-6R 1; Membrane glycoprotein 80; gp80; CD126; IL6R] |
| Gene, Accession # | [IL6R], Gene ID: 3570, NCBI: NP_000556.1, UniProt: P08887 |
| Catalog # | MBS1750643 |
| Price | $280 |
| Order / More Info | IL6R/Il 6 R Alpha Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies