Edit |   |
---|---|
Antigenic Specificity | RDBP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: RDBP antibody was raised against the N terminal of RDBP. Rabbit polyclonal RDBP antibody raised against the N terminal of RDBP |
Immunogen | Immunogen: RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS |
Other Names | [RDBP; RDBP; RDP; D6S45; NELF-E; Rd Rna Binding Protein; RD] |
Gene, Accession # | [RDBP], NCBI: AIC50036.1 |
Catalog # | MBS5302164 |
Price | $430 |
Order / More Info | RDBP Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |