Edit |   |
---|---|
Antigenic Specificity | ITGB6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.25 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms a dimer with an alpha v chain and this heterodimer can bind to ligands like fibronectin and transforming growth factor beta 1. Alternate splicing results in multiple transcript variants. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 732-788 of human ITGB6 (NP 000879.2). Immunogen Sequence: LLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC |
Other Names | [ITGB6; AI1H; integrin beta-6] |
Gene, Accession # | [ITGB6], Gene ID: 3694, NCBI: NP_000879.2, UniProt: P18564 |
Catalog # | MBS9141003 |
Price | $260 |
Order / More Info | ITGB6 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |