Edit |   |
---|---|
Antigenic Specificity | NMDAR1 Picoband |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Glutamate [NMDA] receptor subunit zeta-1 is a protein that in humans is encoded by the GRIN1 gene. The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. Protein Function: NMDA receptor subtype of glutamate-gated i |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human NMDAR1 (FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK). Subcellular Localization: Cell membrane; Enriched in postsynaptic plasma membrane and postsynaptic densities. |
Other Names | [Glutamate receptor ionotropic; NMDA 1; GluN1; Glutamate [NMDA] receptor subunit zeta-1; N-methyl-D-aspartate receptor subunit NR1; NMD-R1; GRIN1; NMDAR1] |
Gene, Accession # | [NMDAR1], Gene ID: 2902, NCBI: NP_000823.4, UniProt: Q05586 |
Catalog # | MBS1750720 |
Price | $280 |
Order / More Info | NMDAR1 Picoband Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |