Edit |   |
---|---|
Antigenic Specificity | GSK3 alpha Picoband |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Glycogen synthase kinase-3 alpha is an enzyme that in humans is encoded by the GSK3A gene. This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease. Protein Function: Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human GSK3 alpha (QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR). |
Other Names | [Glycogen synthase kinase-3 alpha; GSK-3 alpha; Serine/threonine-protein kinase GSK3A; GSK3A] |
Gene, Accession # | [GSK3A], Gene ID: 2931, NCBI: NP_063937.2, UniProt: P49840 |
Catalog # | MBS1750816 |
Price | $280 |
Order / More Info | GSK3 alpha Picoband Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |