Edit |   |
---|---|
Antigenic Specificity | Synuclein Alpha |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Synuclein Alpha antibody |
Immunogen | Immunogen: Synuclein Alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA |
Other Names | [Synuclein Alpha; Synuclein Alpha; PARK1; MGC110988; Non A4 Component Of Amyloid Precursor; NACP; SNCA; PD1; PARK4] |
Gene, Accession # | Gene ID: 6622, NCBI: AAL15443.1 |
Catalog # | MBS5300077 |
Price | $430 |
Order / More Info | Synuclein Alpha Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |