Edit |   |
---|---|
Antigenic Specificity | TSPO |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.32 mg/ml |
Applications | Western Blot (WB), Immunofluorescence (IF) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human TSPO (NP 000705.2). Immunogen Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLG |
Other Names | [TSPO; BPBS; BZRP; DBI; IBP; MBR; PBR; PBS; PKBS; PTBR; mDRC; pk18; translocator protein] |
Gene, Accession # | [TSPO], Gene ID: 706, NCBI: NP_001243460.1, UniProt: P30536 |
Catalog # | MBS9140402 |
Price | $260 |
Order / More Info | TSPO Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |