Edit |   |
---|---|
Antigenic Specificity | ANTP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | Drosophila |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: ANTP antibody was raised against the C terminal Of Antp. Rabbit polyclonal ANTP antibody raised against the C terminal Of Antp |
Immunogen | Immunogen: ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH |
Other Names | [ANTP; ANTP; Dmel_CG1028; Ant; CG1028; Scx; DMANTPE1; DRO15DC96Z; 3.4; Hu; l(3)84Ba; ANT-P; AntP1; ANT-C; DmAntp; AntP] |
Gene, Accession # | [ANTP], NCBI: EDV48084.1 |
Catalog # | MBS5301626 |
Price | $430 |
Order / More Info | ANTP Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |