Edit |   |
---|---|
Antigenic Specificity | MUC3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human. |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit IgG polyclonal antibody for Mucin-3A/Mucin-3B (MUC3A/MUC3B) detection. Background: MUC3 consists of two genes, MUC3A and MUC3B, each encoding membrane-bound mucins possessing 2 epidermal growth factor-like domains. The MUC3 gene is mapped to chromosome 7. It was showed that synthetic peptide-mediated upregulation of MUC3 dramatically inhibited adherence of enteropathogenic E Coli or enterohemorrhage E Coli serotype O157:H7 to HT-29 human intestinal epithelial cells. Peptide stimulation altered expression of a number of transcription factors, including upregulation of SP1, CREB1, and CDX2. These transcription factors bound to consensus sites in the MUC3 promoter upon peptide stimulation and likely mediated MUC3 upregulation. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MUC3 (DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK). |
Other Names | [MUC-3A; MUC3A; MUC 3A; Mucin 3A; MUC-3B; MUC3B; MUC 3B; MUC3; Mucin 3; Q02505; Q9H195; Mucin-3A/Mucin-3B; mucin 3A, cell surface associated/mucin 3B, cell surface associated], [MUC3A; MUC3A; MUC3; MUC-3A; MUC-3ACurated] |
Gene, Accession # | [MUC3A/MUC3B], Gene ID: 4584, NCBI: NP_005951.1, UniProt: Q02505 |
Catalog # | MBS178455 |
Price | $280 |
Order / More Info | MUC3 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Fox, M., Lahbib, F., Pratt, W., Attwood, J., Gum, J., Kim, Y., Swallow, D. M. Regional localisation of MUC3 to chromosome 7q22. (Abstract) Cytogenet. Cell Genet. 58: 1920-1921, 1991.2. Pan, Q., Tian, Y., Li, X., Ye, J., Liu, Y., Song, L., Yang, Y., Zhu, R., He, Y., Chen, L., Chen, W., Mao, X., Peng, Z., Wang, R. Enhanced membrane-tethered mucin 3 (MUC3) expression by a tetrameric branched peptide with a conserved TFLK motif inhibits bacteria adherence. J. Biol. Chem. 288: 5407-5416, 2013. 3. Williams, S. J., Munster, D. J., Quin, R. J., Gotley, D. C., McGuckin, M. A. The MUC3 gene encodes a transmembrane mucin and is alternatively spliced. Biochem. Biophys. Res. Commun. 261: 83-89, 1999. |