Edit |   |
---|---|
Antigenic Specificity | SCTR |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit IgG polyclonal antibody for Secretin receptor(SCTR) detection. Background: Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SCTR (398-440aa EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII). |
Other Names | [SCT-R; SCTR; Secretin receptor; SR; P47872], [SCTR; SCTR; SR; SCT-R] |
Gene, Accession # | [SCTR], Gene ID: 6344, NCBI: NP_002971.2, UniProt: P47872 |
Catalog # | MBS178852 |
Price | $280 |
Order / More Info | SCTR Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Dong M; Miller LJ (2002). Molecular pharmacology of the secretin receptor. Recept. Channels 8 (3-4): 189-200.2. Chow, B. K.-C. Molecular cloning and functional characterization of a human secretin receptor. Biochem. Biophys. Res. Commun. 212: 204-211, 1995.3. Mark, H. F. L., Chow, B. K.-C. Localization of the gene encoding the secretin receptor, SCTR, on human chromosome 2q14.1 by fluorescence in situ hybridization and chromosome morphometry. Genomics 29: 817-818, 1995. |