Rab11A Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Rab11A antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Rab11A |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Ras-related protein Rab-11A(RAB11A) detection. Tested with WB in Human. Background: Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Ras-related protein Rab-11A; MGC1490; Rab 11; Rab 11A; RAB 11A member oncogene family; RAB 11A, member oncogene family; Rab-11; RAB11 A; RAB11; RAB11A; RAB11A member RAS oncogene family; Ras related protein Rab 11A; Ras related protein Rab11A; Ras-related protein Rab-11A; YL 8; YL8; RAB11A, member RAS oncogene family], [RAB11A; RAB11A; YL8; RAB11; Rab-11] |
| Gene, Accession # | [RAB11A], Gene ID: 8766, NCBI: NP_001193765.1, UniProt: P62491 |
| Catalog # | MBS178147 |
| Price | $280 |
| Order / More Info | Rab11A Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Bao, X., Faris, A. E., Jang, E. K., Haslam, R. J. Molecular cloning, bacterial expression and properties of Rab31 and Rab32: new blood platelet Rab proteins. Europ. J. Biochem. 269: 259-271, 2002. 2. Entrez Gene: RAB11A RAB11A, member RAS oncogene family 3. Espevik T, Husebye H, Aune MH, Stenvik J; Samstad E, Skjeldal F, Halaas O, Nilsen NJ, Stenmark H, Latz E, Lien E, Mollnes TE, Bakke O (October 2010). The Rab11a GTPase controls Toll-like receptor 4-induced activation of interferon regulatory factor-3 on phagosomes. Immunity 33 (4): 583-596. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies