Edit |   |
Antigenic Specificity | ZEB1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for ZEB1 detection. Tested with WB, IHC-P, Direct ELISA in human; rat.Background: Zinc finger E-box-binding homeobox 1 is a protein that in humans is encoded by the ZEB1 gene. It is mapped to 10p11.22. This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human ZEB1 (LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ). Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. Relevant Detection Systems: Relevant Detection Systems: We recommend Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC(P). |
Other Names | [Zinc finger E-box-binding homeobox 1; zinc finger E-box binding homeobox 1; Zinc finger E-box-binding homeobox 1; NIL-2-A zinc finger protein; Negative regulator of IL2; Transcription factor 8; TCF-8; ZEB1; AREB6; TCF8] |
Gene, Accession # | [ZEB1], Gene ID: 6935, NCBI: NP_110378, UniProt: P37275 |
Catalog # | MBS1752441 |
Price | $315 |
Order / More Info | ZEB1 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Gupta, R., Kumawat, B. L., Paliwal, P., Tandon, R., Sharma, N., Sen, S., Kashyap, S., Nag, T. C., Vajpayee, R. B., Sharma, A. Association of ZEB1 and TCF4 rs613872 changes with late onset Fuchs endothelial corneal dystrophy in patients from northern India. Molec. Vision 21: 1252-1260, 2015. 2. Hasuwa, H., Ueda, J., Ikawa, M., Okabe, M. MiR-200b and miR-429 function in mouse ovulation and are essential for female fertility. Science 341: 71-73, 2013. |