Edit |   |
Antigenic Specificity | Integrin alpha 1/ITGA1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Integrin alpha 1 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: Integrin alpha 1 (ITGA1) chain associates with the beta 1 (ITGB1) chain to form a heterodimer that functions as a dual laminin/collagen receptor in neural cells and hematopoietic cells. ITGA1 has a 206-amino acid I domain in its N-terminal half, followed by 3 divalent cation-binding sites and a C-terminal transmembrane domain with a short cytoplasmic tail. It also has 28 potential N-glycosylation sites. Human ITGA1 was expressed in a mouse fibroblast cell line as a 180-kD protein. ITGA1 is involved in the early remodeling of osteoarthritic cartilage and p |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human Integrin alpha 1 (TEEVLVAAKKIVQRGGRQTMTALGIDTARKEAFTEAR). |
Other Names | [Integrin alpha-1; CD49 antigen-like family member A; Laminin and collagen receptor; VLA-1; CD49a; ITGA1; Integrin subunit alpha 1] |
Gene, Accession # | [ITGA1], Gene ID: 3672, NCBI: NP_852478.1, UniProt: P56199 |
Catalog # | MBS1751462 |
Price | $315 |
Order / More Info | Integrin alpha 1/ITGA1 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Douville, P.; Seldin, M. F.; Carbonetto, S.: Genetic mapping of the integrin alpha-1 gene (Vla1) to mouse chromosome 13. Genomics 14: 503-505, 1992. 2. Lee HJ, Kim SY; Koh JM; Bok J; Kim KJ; Kim KS; Park MH; Shin HD; Park BL; Kim TH; Hong JM; Park EK; Kim DJ; Oh B; Kimm K; Kim GS; Lee JY. Polymorphisms and haplotypes of integrinalpha1 (ITGA1) are associated with bone mineral density and fracture risk in postmenopausal Koreans.Bone. 2007 Dec; 41 (6):979-86. Epub 2007 Sep 5. 3. Ekholm, E.; Hankenson, K. D.; Uusitalo, H.; Hiltunen, A.; Gardner, H.; Heino, J.; Penttinen, R.: Diminished callus size and cartilage synthesis in alpha-1 beta-1 integrin-deficient mice during bone fracture healing. Am. J. Path. 160: 1779-1785, 2002. |