Edit |   |
Antigenic Specificity | Aquaporin 5/AQP5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Aquaporin 5 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: Aquaporin 5, also known as AQP5, is a water channel protein. The aquaporins (AQPs) are a family of more than 10 homologous water transporting proteins expressed in many mammalian epithelia and endothelia. At least five AQPs are expressed in the eye: AQP0 (MIP) in lens fiber, AQP1 in cornea endothelium, ciliary and lens epithelia and trabecular meshwork, AQP3 in conjunctiva, AQP4 in ciliary epithelium and retinal Mueller cells, and AQP5 in corneal and lacrimal gland epithelia. Among the seven human aquaporins cloned to date (AQPs 0-6), genes encoding the four mo |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human Aquaporin 5 (NSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR). |
Other Names | [Aquaporin-5; AQP-5; AQP5; Aquaporin 5] |
Gene, Accession # | [AQP5], Gene ID: 362, NCBI: NP_001642.1, UniProt: P55064 |
Catalog # | MBS1751445 |
Price | $315 |
Order / More Info | Aquaporin 5/AQP5 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Verkman AS (2003). Role of aquaporin water channels in eye function.. Exp. Eye Res. 76 (2): 137-43. 2. Ma T, Yang B, Umenishi F, Verkman AS (1997). Closely spaced tandem arrangement of AQP2, AQP5, and AQP6 genes in a 27-kilobase segment at chromosome locus 12q13.. Genomics 43 (3): 387-9. |